- UAF1/WDR48 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49269
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- Immunogen affinity purified
- UAF1/WDR48
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: SDMLQVRKVM EHVYEKIINL DNESQTTSSS NNEKPGEQEK EEDIAVLAEE KIELLCQDQV LDPNMDLRTV KHFIWKSGGD LTLHYR
- Primary Antibodies
- WD repeat domain 48
- Bun62, P80, SPG60, UAF1
- Polyclonal
- Novus Biologicals, a Bio-Techne Brand
- Cell Biology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Specifications/Features
Available conjugates: Unconjugated
Sequence
SDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYR